General Information

  • ID:  hor005666
  • Uniprot ID:  Q9I8P2
  • Protein name:  Peptide YY-A
  • Gene name:  pyya
  • Organism:  Danio rerio (Zebrafish) (Brachydanio rerio)
  • Family:  NPY Family
  • Source:  animal
  • Expression:  Mainly expressed in brainstem neurons, and in the telencephalon. Also expressed in intestinal endocrine cells.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Danio (genus), Danioninae (subfamily), Danionidae (family), Cyprinoidei (suborder), Cypriniformes (order), Cypriniphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding; GO:0031841 neuropeptide Y receptor binding; GO:0031843 type 2 neuropeptide Y receptor binding
  • GO BP:  GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior
  • GO CC:  GO:0005576 extracellular region; GO:0005615 extracellular space

Sequence Information

  • Sequence:  YPPKPENPGDDAAPEELAKYYTALRHYINLITRQRY
  • Length:  36
  • Propeptide:  MAVMLKPWTVVATVLICVLLCLGTFVDAYPPKPENPGDDAAPEELAKYYTALRHYINLITRQRYGKRSTSEDVMAELLFGDDTEHKQRSRYDDSFMW
  • Signal peptide:  MAVMLKPWTVVATVLICVLLCLGTFVDA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NA
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9I8P2-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor005666_AF2.pdbhor005666_ESM.pdb

Physical Information

Mass: 488923 Formula: C194H292N52O57
Absent amino acids: CFMSVW Common amino acids: PY
pI: 7.51 Basic residues: 6
Polar residues: 10 Hydrophobic residues: 9
Hydrophobicity: -114.44 Boman Index: -9027
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 65.28
Instability Index: 6689.72 Extinction Coefficient cystines: 7450
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  10936170
  • Title:  Zebrafish Genes for Neuropeptide Y and Peptide YY Reveal Origin by Chromosome Duplication From an Ancestral Gene Linked to the Homeobox Cluster